<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26913
| Description |
Mediator of RNA polymerase II transcription subunit 28 |
| Sequence | MAAPLGGMFSGQPPGPPQPPPGLLGQASLLQATPGVPRTSNSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINMQHKKPADIPQGSLAYLEQASANIPAPMKQT |
| Length | 178 |
| Position | Head |
| Organism | Bos taurus (Bovine) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Ruminantia> Pecora> Bovidae>
Bovinae> Bos.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.486 |
| Instability index | 57.72 |
| Isoelectric point | 5.39 |
| Molecular weight | 19732.23 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP26913
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.88| 21| 138| 12| 37| 2
---------------------------------------------------------------------------
12- 37 (31.14/24.32) QPPGPPQpppGLLgqASLLQATPGVP
152- 172 (38.75/16.25) KPADIPQ...GSL..AYLEQASANIP
---------------------------------------------------------------------------
|