<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26911
| Description |
Mediator of RNA polymerase II transcription subunit 9 |
| Sequence | MASVGVAAGRQAEDTLPPPAEPPLPEMKPLPQPQPPPSVSAQQPQPVPKPPSPAGVKAEENCSFLPLVHSIIKCMDKDSPDIHQDLNTLKAKFQEMRKVVSTMPGIHLSPEQQQQQLQRLREQVRTKNELLQKYKSLCMFEIPKE |
| Length | 145 |
| Position | Middle |
| Organism | Bos taurus (Bovine) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.681 |
| Instability index | 80.39 |
| Isoelectric point | 7.72 |
| Molecular weight | 16143.55 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP26911
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.04| 15| 15| 28| 42| 1
---------------------------------------------------------------------------
28- 42 (30.99/10.11) KPLPQPQPPPSVSAQ
45- 59 (29.05/ 9.09) QPVPKPPSPAGVKAE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.41| 21| 22| 80| 100| 2
---------------------------------------------------------------------------
80- 100 (35.75/20.55) PDIHQDLNTLKAKFQEMRKVV
104- 124 (36.66/21.23) PGIHLSPEQQQQQLQRLREQV
---------------------------------------------------------------------------
|