<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26903
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MQNNVSPPQQQAQQIENVSAFPPPPQFYKLYLNYTKDQFKDRENKEKIDTTTTNNNNNNNNNEEKQQSQDDQQQMNVDDDKDKKKDKKAELNKPLPPPIPPKMGSHYVQFGQNYSTVDMLPSLDESGSKQLYPKGDIEPIAELKKLNRSILFNYLQLLETLIENPTNYQKKIDDISLLFINFHHLLNSYRPHQARETLLSIMNEQIKQKFQSNETIKKSLEICKESIKKSFNHLQVETTNPITPNPNINPQSTDGLAQTSQPQKPQQNQNNDINMGETNWMDQLLDEMLEIN |
Length | 292 |
Position | Middle |
Organism | Dictyostelium purpureum (Slime mold) |
Kingdom | Amoebozoa |
Lineage | Eukaryota> Amoebozoa> Evosea> Eumycetozoa> Dictyostelia> Dictyosteliales>
Dictyosteliaceae> Dictyostelium.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -1.137 |
Instability index | 46.54 |
Isoelectric point | 5.37 |
Molecular weight | 33900.45 |
Publications | PubMed=21356102
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP26903
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.00| 18| 19| 229| 247| 3
---------------------------------------------------------------------------
229- 247 (28.77/20.89) KSFNHLqVETTNPITPNPN
251- 268 (32.23/18.64) QSTDGL.AQTSQPQKPQQN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.01| 15| 18| 60| 76| 4
---------------------------------------------------------------------------
62- 76 (25.59/15.77) NEEKQQSQDDQQQMN
78- 92 (23.42/ 7.47) DDDKDKKKDKKAELN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.23| 16| 73| 21| 37| 6
---------------------------------------------------------------------------
22- 37 (32.54/14.88) PP..PPQFYKLYLNYTKD
96- 113 (28.69/ 8.76) PPpiPPKMGSHYVQFGQN
---------------------------------------------------------------------------
|