<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26893
| Description |
Cyclin-dependent protein |
| Sequence | MGYQSRVRVTDKYRVIGFISSGTYGRVYKAVGRQGQQGEFAIKKFKPDKEGEQIAYTGISQSAVREMALCTELSHTNVIRLVEIILEDKCIFMVFEFAEHDLLQIIHHHTQQPRHPIPSTSIKSIMFQLLNGCQYLHTNWVLHRDLKPANIMVTSGGQVKIGDLGLARLFYKPLHSLFSGDKVVVTIWYRAPELLLGSRHYTPAIDMWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMQKIVDIMGLPTKERWPLLVNMPEYQQLSTLQSPLGNQHRHHHSHHHHVSSPLPIQNTSNLEKWYYSTIGHGQTSSPAHHNAIGSTGSASLGVEGYKLLSGLLEYDPEKRLTAEQALSHPFFSTGDILTSNCFEGLRMEYPNRRVSQDDNDIRTSSLPGTKRGGLPDDSIVRASKRIKE |
| Length | 422 |
| Position | Kinase |
| Organism | Grosmannia clavigera (strain kw1407 / UAMH 11150) (Blue stain fungus) (Graphiocladiella clavigera) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Ophiostomatales> Ophiostomataceae> Grosmannia.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.385 |
| Instability index | 37.01 |
| Isoelectric point | 9.09 |
| Molecular weight | 47735.08 |
| Publications | PubMed=21262841
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP26893
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 89.76| 26| 32| 269| 294| 1
---------------------------------------------------------------------------
269- 294 (49.45/31.69) QQLSTLQ....SPLGNQHRHHHSHHHHVSS
299- 328 (40.31/24.51) QNTSNLEkwyySTIGHGQTSSPAHHNAIGS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.09| 14| 32| 344| 358| 2
---------------------------------------------------------------------------
344- 358 (20.56/18.39) GL.LEYdPEKRLTAEQ
378- 392 (22.53/14.28) GLrMEY.PNRRVSQDD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.16| 11| 29| 163| 173| 6
---------------------------------------------------------------------------
163- 173 (19.93/12.11) DLGLARLFYKP
193- 203 (20.23/12.39) ELLLGSRHYTP
---------------------------------------------------------------------------
|