<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26892
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MAPIEPSPTAPAEAAIRDTIQSLYNVMLHTSAYDAAGPQTTLDALVAEVQVLSRALQSAAAASSTTTSTTTTTTTALPSVPRDLVQYVEAGRNPDIYTREFVELVRRTNQLRAGKRAAFAQFRDVLAGQIRSALPELQPDVDRVVESTGGGRGTAKTSEHEPGQESGQEPGRNAVSVPTTTTNTSASTSTPSTAPALASSFAPSSHSAPTSAPAHTVSLTNRSMSASASASASASASASPPLGLTGGTPGSDAGGSTIDMLGMLPGTPQTNTALPPTSNTAAAPTSAAAGRPDGNAMQTT |
| Length | 300 |
| Position | Middle |
| Organism | Grosmannia clavigera (strain kw1407 / UAMH 11150) (Blue stain fungus) (Graphiocladiella clavigera) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Ophiostomatales> Ophiostomataceae> Grosmannia.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.286 |
| Instability index | 46.09 |
| Isoelectric point | 5.37 |
| Molecular weight | 30244.88 |
| Publications | PubMed=21262841
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26892
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 88.09| 28| 34| 176| 209| 1
---------------------------------------------------------------------------
176- 209 (44.22/21.84) SVPTTT...TNTSASTStpstapALASSFAPSSHSAP
211- 241 (43.87/13.34) SAPAHTvslTNRSMSAS......ASASASASASASPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 105.72| 34| 196| 61| 95| 2
---------------------------------------------------------------------------
61- 95 (54.66/23.89) AASST.....TTSTTTTTTTALPSVPRDLV..QYVEAGRnPD
253- 293 (51.05/18.90) AGGSTidmlgMLPGTPQTNTALPPTSNTAAapTSAAAGR.PD
---------------------------------------------------------------------------
|