<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26884
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MATGPPPPPTADLFHTRFEIECEFVSCLANPYYLQYLAAEKYFDDPRFVRYLRYLLYWREPPYLQYLSWPGPTLRHLELLQTAAFRQAIISPEVVARMEREDIQAAFRWQQQP |
Length | 113 |
Position | Middle |
Organism | Grosmannia clavigera (strain kw1407 / UAMH 11150) (Blue stain fungus) (Graphiocladiella clavigera) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Ophiostomatales> Ophiostomataceae> Grosmannia.
|
Aromaticity | 0.17 |
Grand average of hydropathy | -0.370 |
Instability index | 63.59 |
Isoelectric point | 5.63 |
Molecular weight | 13515.33 |
Publications | PubMed=21262841
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:EnsemblFungi
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | DNA repair GO:0006281 IEA:EnsemblFungi
meiotic gene conversion GO:0006311 IEA:EnsemblFungi
meiotic sister chromatid segregation GO:0045144 IEA:EnsemblFungi
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription by RNA polymerase II GO:0006366 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP26884
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.88| 13| 28| 30| 46| 1
---------------------------------------------------------------------------
30- 46 (22.60/15.61) NPYYLQYLAaekyFDDP
60- 72 (30.28/12.57) EPPYLQYLS....WPGP
---------------------------------------------------------------------------
|