Description | Med9 RNA polymerase 2 transcription mediator |
Sequence | MADKNTADRLSQVQDAVDQLAHQFLTCLFFLDRHHSLQKLSPNDVVQEQKSDSSQPRALTVEPIPPDDFKQGQEELARDLVYKEQQIEFLIGNLPGLENTEQDQERLIRELEEELKVAEAQRKEAVKEKDEMLAKLDRVIRSIKRP |
Length | 146 |
Position | Middle |
Organism | Grosmannia clavigera (strain kw1407 / UAMH 11150) (Blue stain fungus) (Graphiocladiella clavigera) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Ophiostomatales> Ophiostomataceae> Grosmannia. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.819 |
Instability index | 46.21 |
Isoelectric point | 4.89 |
Molecular weight | 16918.84 |
Publications | PubMed=21262841 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP26881 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 60.21| 17| 22| 33| 49| 2 --------------------------------------------------------------------------- 33- 49 (29.68/19.63) RHHSLQKLSPNDVVQEQ 57- 73 (30.53/20.37) RALTVEPIPPDDFKQGQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 46.23| 15| 16| 101| 115| 3 --------------------------------------------------------------------------- 101- 115 (23.15/12.64) EQDQERLIRELEEEL 119- 133 (23.08/12.58) EAQRKEAVKEKDEML --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) QERLIRE 2) QPRALTVEPIPPDDFKQGQEELARDLVYKEQQIEFLIGNLPGLEN | 104 55 | 110 99 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab