| Description | Med9 RNA polymerase 2 transcription mediator |
| Sequence | MADKNTADRLSQVQDAVDQLAHQFLTCLFFLDRHHSLQKLSPNDVVQEQKSDSSQPRALTVEPIPPDDFKQGQEELARDLVYKEQQIEFLIGNLPGLENTEQDQERLIRELEEELKVAEAQRKEAVKEKDEMLAKLDRVIRSIKRP |
| Length | 146 |
| Position | Middle |
| Organism | Grosmannia clavigera (strain kw1407 / UAMH 11150) (Blue stain fungus) (Graphiocladiella clavigera) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Ophiostomatales> Ophiostomataceae> Grosmannia. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.819 |
| Instability index | 46.21 |
| Isoelectric point | 4.89 |
| Molecular weight | 16918.84 |
| Publications | PubMed=21262841 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU366036 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats |
>MDP26881
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.21| 17| 22| 33| 49| 2
---------------------------------------------------------------------------
33- 49 (29.68/19.63) RHHSLQKLSPNDVVQEQ
57- 73 (30.53/20.37) RALTVEPIPPDDFKQGQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.23| 15| 16| 101| 115| 3
---------------------------------------------------------------------------
101- 115 (23.15/12.64) EQDQERLIRELEEEL
119- 133 (23.08/12.58) EAQRKEAVKEKDEML
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) QERLIRE 2) QPRALTVEPIPPDDFKQGQEELARDLVYKEQQIEFLIGNLPGLEN | 104 55 | 110 99 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab