<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26876
Description |
Uncharacterized protein |
Sequence | MADILTQLQTCLDQLATQFYATLCYLTTYHDHAAATPPSNIPTAIPQLKKIPKNPSPTATTSTTAKAASPQPTTPAAADAQAQQQEPSPAEPTPDPPEIFALRQRELARDLIVKEQQIEYLISVLPGVGSSEAEQEERIRRLAEELRVVEAERREKRRQMRKLGERVDELLGAVEGTG |
Length | 178 |
Position | Middle |
Organism | Ajellomyces capsulatus (strain H88) (Darling's disease fungus) (Histoplasma capsulatum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Ajellomycetaceae> Histoplasma.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.573 |
Instability index | 67.21 |
Isoelectric point | 5.19 |
Molecular weight | 19594.90 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP26876
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.09| 17| 18| 69| 85| 1
---------------------------------------------------------------------------
69- 85 (29.72/14.34) SPQPTTPAAADAQAQQQ
88- 104 (29.37/14.09) SPAEPTPDPPEIFALRQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 72.29| 17| 18| 134| 150| 2
---------------------------------------------------------------------------
114- 129 (20.47/14.19) .KEQQIEYLISVLPGVG
134- 150 (26.91/20.90) EQEERIRRLAEELRVVE
155- 169 (24.91/18.81) EKRRQMRKLGE..RVDE
---------------------------------------------------------------------------
|