<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26871
Description |
Meiotic mRNA stability protein kinase UME5 |
Sequence | MSKRRFRDMNSLRASVLRDTLEPRKSPGIGYTSKVHIREKYHIVGFISSGTYGRVYKAIGRNSQKREFAIKKFKPDKEGEIVQYTGLSQSAIREIALCSELSHANVVHLEEIILEDKCIFMVFEYTEHDLLQIIHHHTQAQRHPIPAPMIKSILFQLLNGLLYLHSNWVLHRDLKPANILVTSTGAVRIGDLGLARLFYKPLNSLFSGDKVVVTIWYRAPELLLGSRHYTPAIDLWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMLKIIEILGVPKKETWPGLTAMPEYAQFQTLVLARGGSHVNKPSNLEAWYHACANAAGYPSSPSGSPGREGFDLLSRLLEYDPEKRLTAEEALKHPYFSIGSPVTANCFEGFEGKYPNRRVSQDDNDIRTSSLPGTKKSGLPDDTLTSRVAKRHKEG |
Length | 428 |
Position | Kinase |
Organism | Ajellomyces capsulatus (strain H88) (Darling's disease fungus) (Histoplasma capsulatum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Ajellomycetaceae> Histoplasma.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.337 |
Instability index | 46.69 |
Isoelectric point | 9.35 |
Molecular weight | 48281.99 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP26871
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.07| 12| 33| 327| 338| 1
---------------------------------------------------------------------------
327- 338 (23.49/15.16) AAGYPSSPSGSP
363- 374 (23.58/15.25) ALKHPYFSIGSP
---------------------------------------------------------------------------
|