<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26870
| Description |
Cyclin |
| Sequence | MAANYWVSTQRRNWLFERDQLAEIRRSLDEGDKQKQLIQQFPLPDLRYFSIYINLQLVRLGKRMTIRQQALATAQVYIRRFYTKVEIRRTNPYLVLTTAFYLACKMEECPQHIRFVVSEAKGLWPDFIVSDISKLGECEFWLISEMNSQLIVHHPYRSLSELQSTLSLTSEEVSLAWSIINDHYLTDLPLLQPPHVVAVTAIILAVGLKTNTTSSAHLAGASPVSAALRDGAGALTALSDKNLPSRAQMLVDWLSAGEVNIEAVIECTQELISLYEAWEQYSEKGCREQISRYVKARSLDK |
| Length | 301 |
| Position | Kinase |
| Organism | Ajellomyces capsulatus (strain H88) (Darling's disease fungus) (Histoplasma capsulatum) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Ajellomycetaceae> Histoplasma.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.120 |
| Instability index | 60.17 |
| Isoelectric point | 6.61 |
| Molecular weight | 34354.06 |
| Publications | |
Function
| Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The SRB8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II.
Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The srb8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26870
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.36| 24| 24| 51| 74| 1
---------------------------------------------------------------------------
51- 74 (38.78/26.02) IYINLQLVRLGKRMTIRQQALATA
76- 99 (40.58/27.50) VYIRRFYTKVEIRRTNPYLVLTTA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.12| 24| 26| 140| 163| 2
---------------------------------------------------------------------------
140- 163 (43.84/37.54) FWLISE...MNSQLIVHHPYRSLSELQ
166- 192 (36.28/29.65) LSLTSEevsLAWSIINDHYLTDLPLLQ
---------------------------------------------------------------------------
|