Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MEPQEPDRVFTSADRIRELNDIDKDVAKLLNAAGVAIGSLTNSPSVTSGQSSSDLPKIDGTLESHRAAFKAASSQYFALLSSIDVRLRRQVYALEEASIIQPESAEVTAGGTTTSASATSSGGVNPLDTSWLNSRKDTVGKDKEAELWAEASKFAIQLEKAKGPSENESGS |
Length | 171 |
Position | Head |
Organism | Ajellomyces capsulatus (strain H88) (Darling's disease fungus) (Histoplasma capsulatum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Onygenales> Ajellomycetaceae> Histoplasma. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.453 |
Instability index | 36.77 |
Isoelectric point | 4.80 |
Molecular weight | 18102.70 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP26867 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 44.30| 13| 34| 11| 23| 1 --------------------------------------------------------------------------- 11- 23 (21.84/14.90) TSADRIRELNDID 47- 59 (22.46/15.51) TSGQSSSDLPKID --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GTLESHRA 2) SWLNSRKDTVGKDKEAELWAEASKFAIQLEKAKGPSENE | 60 130 | 67 168 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab