<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26853
| Description |
"Transcription elongation factor A (SII), 3 (Fragment)" |
| Sequence | MTREEDLLRIAKKLDKMVSRNNMDGALDLLRELKDFNMTLKLLQDTRIGMSVNGIRKHCTDEDVVNLAKILIKNWKRLLESAQNPKSERPNEVKNGSHPSKPSGSPSRTSPEKDSRKDSTDSKKPLPRKPSLDGRRDSKDSTDSKSSNHLLKRQSSEPKLERRDSTNSRSGSSPQAKKSCESKSKPETPKTPTTPTSPLSPSFSSSAGPLSPRLQTGDSIRDKCIEMLTAALRTDDDYKDYGTNCEAMGAEIEDYIYQETKATDMKYKNRVRSRISNLKDPKNPNLRKNVLAGAIELSRIASMTA |
| Length | 305 |
| Position | Unknown |
| Organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Cypriniformes>
Danionidae> Danioninae> Danio.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.078 |
| Instability index | 60.03 |
| Isoelectric point | 9.63 |
| Molecular weight | 34094.12 |
| Publications | PubMed=23594743
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26853
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 75.00| 21| 21| 111| 131| 1
---------------------------------------------------------------------------
97- 115 (23.40/ 7.13) SHPSKPSG..SP...SRTsPE.KDS
116- 137 (30.00/10.92) RKDSTDSK..KPLPRKPSlDG.RRD
138- 161 (21.60/ 6.10) SKDSTDSKssNHLLKRQS.SEpKLE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.78| 17| 21| 173| 190| 3
---------------------------------------------------------------------------
173- 190 (26.83/18.30) SPQAkKSCESKSKPETPK
197- 213 (30.95/16.86) SPLS.PSFSSSAGPLSPR
---------------------------------------------------------------------------
|