<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26849
Description |
Mediator of RNA polymerase II transcription subunit 16 (Fragment) |
Sequence | MMDLAYVCEWEKWAKSTYCPSLPLACAWSCRNLIAFTTDLRNDDQDLTHMIHILDTEHPWEVHSVSSGHSEAITCLEWDQSGSRLLSADADGQIKCWSMADHLANSWESSVGSQVEGDPIVALSWLHNGVKLALHVEKSGASSFGEKFSRVKFSPSLTLFGG |
Length | 162 |
Position | Tail |
Organism | Mus musculus (Mouse) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae>
Murinae> Mus> Mus.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.169 |
Instability index | 39.39 |
Isoelectric point | 5.07 |
Molecular weight | 17956.98 |
Publications | PubMed=19468303
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364149
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP26849
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 94.70| 26| 46| 60| 85| 1
---------------------------------------------------------------------------
60- 85 (48.06/28.25) WEVHSVSSGHSEAITCLEWDQSGSRL
107- 132 (46.63/27.22) WESSVGSQVEGDPIVALSWLHNGVKL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.59| 14| 133| 11| 24| 2
---------------------------------------------------------------------------
11- 24 (28.14/20.54) EKWAKSTYCPSLPL
146- 159 (24.45/17.00) EKFSRVKFSPSLTL
---------------------------------------------------------------------------
|