<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26842
Description |
Mediator of RNA polymerase II transcription subunit 17 (Fragment) |
Sequence | MSGVRAVRISIESACEKQVHEVGLDGTETYLPPLSMSQNLARLAQRIDFSQGSGSEEEEAAGTEGDAQEWPGAGSSADQDDEEGVVKFQPSLWPWDSVRNNLRSALTEMCVLYDVLSIVRDKKFMTLDPVSQDALPPKQDRGLAIYKERNGSTLRGDPNRLDRVDAMNPQTLQLISKKKSLAGAAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKI |
Length | 231 |
Position | Head |
Organism | Homo sapiens (Human) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Homo.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.650 |
Instability index | 48.60 |
Isoelectric point | 5.61 |
Molecular weight | 25763.73 |
Publications | PubMed=16554811
PubMed=17525332
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP26842
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.85| 20| 20| 52| 71| 2
---------------------------------------------------------------------------
52- 71 (35.51/24.92) GSGSEEEEAAG.TEGDAQEWP
74- 94 (32.34/22.04) GSSADQDDEEGvVKFQPSLWP
---------------------------------------------------------------------------
|
Associated diseases