<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26838
| Description |
Uncharacterized protein (Fragment) |
| Sequence | KPANILVMGEGIERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPHDKDWEDIKKMPEHPTLLKDFKRNNYQTCSLMKYMDRYKIKADTKAFHLVIDI |
| Length | 163 |
| Position | Kinase |
| Organism | Daphnia pulex (Water flea) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Crustacea> Branchiopoda>
Diplostraca> Cladocera> Anomopoda> Daphniidae> Daphnia.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.307 |
| Instability index | 32.33 |
| Isoelectric point | 7.90 |
| Molecular weight | 19033.94 |
| Publications | PubMed=21292972
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
nucleus GO:0005634 IBA:GO_Central
|
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
cyclin-dependent protein serine/threonine kinase activity GO:0004693 IBA:GO_Central
RNA polymerase II CTD heptapeptide repeat kinase activity GO:0008353 IBA:GO_Central
|
| GO - Biological Process | protein phosphorylation GO:0006468 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP26838
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 32.77| 9| 26| 87| 96| 1
---------------------------------------------------------------------------
87- 96 (14.34/12.31) EDIKtSNPYH
116- 124 (18.43/10.58) EDIK.KMPEH
---------------------------------------------------------------------------
|