<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26837
Description |
Mediator of RNA polymerase II transcription subunit 17 |
Sequence | MIKVTIPTELGGTAYIQVTIQKDQDILCITNLNLLHASLTHSDPSRDANPWTGKLEAAQNVLFCKELFSHLAREAVQLQAAIPHMVVGNQITASLFPGIQLSIHFQSSQSVGVEKRQPVSNSTSPIAKVDHNYILEHSLHQLLRQVHLKNVGQPVPHPSSAPLGPTKRRRLAGPHAYDRDELLSMTKKYDTVG |
Length | 193 |
Position | Head |
Organism | Daphnia pulex (Water flea) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Crustacea> Branchiopoda>
Diplostraca> Cladocera> Anomopoda> Daphniidae> Daphnia.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.250 |
Instability index | 39.16 |
Isoelectric point | 8.93 |
Molecular weight | 21286.13 |
Publications | PubMed=21292972
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364140
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP26837
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 124.76| 38| 50| 80| 117| 1
---------------------------------------------------------------------------
80- 117 (63.81/39.51) AAIPHMVVGNQITASLFPGIQL.....SIHFQSSQSVGVEKRQ
127- 169 (60.95/37.44) AKVDHNYILEHSLHQLLRQVHLknvgqPVPHPSSAPLGPTKRR
---------------------------------------------------------------------------
|