<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26830
| Description |
Uncharacterized protein (Fragment) |
| Sequence | MASDHSNHGLLANNTNLVDDFEEAFQDNKEELRTDAEQNVAKFIEVAKQLETFFLQRRLQISVLKPEQLIKEDCSELKQELARKDELIKKHYEKISIWLNMLGEPHPPAPVANGVPV |
| Length | 117 |
| Position | Head |
| Organism | Daphnia pulex (Water flea) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Crustacea> Branchiopoda>
Diplostraca> Cladocera> Anomopoda> Daphniidae> Daphnia.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.588 |
| Instability index | 55.31 |
| Isoelectric point | 5.06 |
| Molecular weight | 13436.07 |
| Publications | PubMed=21292972
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP26830
No repeats found
No repeats found
|