<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26826
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MANQNPFSAIELFTSALRSNIIPNQEYLLQGSVIDSSAEVLHNRLRGLCDAAETGPETFHDHEMCFSLKASNPGGTPQQQQPFLLRVRRALDHPEYPWQLRYLGQPELGDKNQPTVLRSCIDIACTPNVVEFLSELGCRIEFEYVLKGYLFRKGRMKVTMSKIFRMGQAKSPDSLESVTGSYLVELSLLAPSGQDAVADEIKVFAEQLRPLVHLEKIDYRRLQQPFT |
| Length | 227 |
| Position | Head |
| Organism | Daphnia pulex (Water flea) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Crustacea> Branchiopoda>
Diplostraca> Cladocera> Anomopoda> Daphniidae> Daphnia.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.303 |
| Instability index | 58.28 |
| Isoelectric point | 5.98 |
| Molecular weight | 25672.07 |
| Publications | PubMed=21292972
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
termination of RNA polymerase II transcription GO:0006369 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP26826
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.89| 15| 15| 29| 43| 1
---------------------------------------------------------------------------
29- 43 (24.12/16.60) LQG..SVIDSSAEVLHN
45- 61 (21.77/14.37) LRGlcDAAETGPETFHD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.39| 11| 14| 91| 101| 2
---------------------------------------------------------------------------
91- 101 (23.10/11.25) LDHPEYPWQLR
108- 118 (19.29/ 8.60) LGDKNQPTVLR
---------------------------------------------------------------------------
|