<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26824
Description |
Mediator of RNA polymerase II transcription subunit 15 |
Sequence | MMGSGGGGTEEQMYLEKVRQLSRFIEPLTCLIGRIGDVDSEKLSKMKIMLDILSNPSKRMPMDTLLKCEAVLEKMDFKKVNYNNPPAATPLLSLLETIANQARSPYINHTLQRTFAPAVNSLIGCDIAAPTAPKKRLDSADDDKADELMYTIEREVANLYPRFKVDLDQLHLFGSQDLHLICRLEDKYLPSVPSLRIVVPRDYPRTAPFCDSRQPDYDVSGFTRTVLQGLSDRLRHMPHRFTVSQILNCWEMALRHACKPSNSSNDNASNRDVSALTVALGV |
Length | 282 |
Position | Tail |
Organism | Daphnia pulex (Water flea) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Crustacea> Branchiopoda>
Diplostraca> Cladocera> Anomopoda> Daphniidae> Daphnia.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.323 |
Instability index | 54.41 |
Isoelectric point | 7.00 |
Molecular weight | 31684.14 |
Publications | PubMed=21292972
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364148
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP26824
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.38| 22| 26| 43| 67| 1
---------------------------------------------------------------------------
43- 67 (34.70/26.44) LSKM...KIMLDilsNPSKRMPMDTLLK
72- 96 (33.67/18.40) LEKMdfkKVNYN...NPPAATPLLSLLE
---------------------------------------------------------------------------
|