Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MPIERLQALDNVEKEIASCIQSAGQALTELSKDKASMKQVESHTSLFLKTLNHVEGELSKHINYLTQVSTGSPHEGTSYGSVKMYKTARHRIEHTRTRLQDLENLKNRALASSVRPTSAQNNP |
Length | 123 |
Position | Head |
Organism | Daphnia pulex (Water flea) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Crustacea> Branchiopoda> Diplostraca> Cladocera> Anomopoda> Daphniidae> Daphnia. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.703 |
Instability index | 47.86 |
Isoelectric point | 9.13 |
Molecular weight | 13728.31 |
Publications | PubMed=21292972 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP26823 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 58.16| 12| 26| 29| 40| 1 --------------------------------------------------------------------------- 11- 22 (18.72/11.49) NVEKEIASCIQS 29- 40 (19.48/12.16) ELSKDKASMKQV 57- 68 (19.96/12.59) ELSKHINYLTQV --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) PHEGTSYGSVKMYKTARHRIEHTRTRLQDLENLKNRALA 2) TLNHVEGELSKHINYLTQVST | 73 50 | 111 70 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab