<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26819
Description |
Uncharacterized protein |
Sequence | MNVAACDANTPWDTHIVKSCVAQVTVLEWDQSGHYLLIGDTVAAANAEIWTTPTHLLNEWTRVANICIPDEPIQA |
Length | 75 |
Position | Tail |
Organism | Daphnia pulex (Water flea) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Crustacea> Branchiopoda>
Diplostraca> Cladocera> Anomopoda> Daphniidae> Daphnia.
|
Aromaticity | 0.07 |
Grand average of hydropathy | 0.080 |
Instability index | 31.62 |
Isoelectric point | 4.34 |
Molecular weight | 8244.20 |
Publications | PubMed=21292972
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | |
GO - Biological Process | positive regulation of transcription, DNA-templated GO:0045893 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP26819
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.79| 17| 18| 37| 53| 2
---------------------------------------------------------------------------
37- 53 (29.09/16.55) LIGDTVAAANAEIWTTP
56- 72 (31.69/18.53) LLNEWTRVANICIPDEP
---------------------------------------------------------------------------
|