<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26818

Description Mediator of RNA polymerase II transcription subunit 16
SequenceMDLIAVVRRSHYEESPRKRQRLNTGNSPWENESDIGVTACAVSPQNVIAFACYGTLKSSTAGPSDQNMNVVVCDANTPWDTHIVKSCVAQVTVLEWDQSGHYLLIGDTAGNAEIWTTLTHLLNEWTRVANICIPDEPIQAGMFFFNGKKTFLNCQNRESVSYLDKYIQVDMKPTIRGFGGRPLQGFLVVGMTGLVQAFVMGGTKGKTTNVEILGGIRLAYSFVDLAWTKDGEILAVACTGIPLDPIVYCKLTIQKDDGVEFSCLLDEYRLRSETLTGLFPLQSGANEMRVCGVNFSSREDPSGIFLVVNGINSGTLQYWELSEVERTIHSLFSTSAAMSRFLQWQCMSVFNCNSRITYVCPSRNVWVNGQEAGSPPQHHLVIATVCGELLCLHRESMKQVGHLSIVDRSKCESAQSKTVSSACFTATGNALIAFDNTATMFVCKLSPITDPGAAVTIPYALMSLEYCLLTGIDYWDVLIGLRSTMLDSLCERLTDSFNQQSIGLQQLLQYRLLNIKLAIFRLGPTASSKAGLQYGIIMLNSVYYALKSLLRPPSELFNQDRAPAESLTAVLSSKVPEVGTEVDKVLLHLEVKEFTVEASTLITVQHLIQWTVTFILRLLNNLPDWRTATTTRGTMCDMLRDPKLLNMFRELLVIFRIWGLIRHSCLPTFSYMENVDVIATLFRILTRLLQTSEPDESLLDECCQLSSQLIIPDIGLSLPARGIASPTLFNQLPLQYEYGSHPEEPSSTKYDGVEGESKVDSIRHVYLGSKPHNVRYCSRCKGISIVVKGLRVGRSAAAKSWDMRWQMSCICRGKWSRQEVQ
Length821
PositionTail
OrganismDaphnia pulex (Water flea)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Crustacea> Branchiopoda> Diplostraca> Cladocera> Anomopoda> Daphniidae> Daphnia.
Aromaticity0.08
Grand average of hydropathy0.004
Instability index42.86
Isoelectric point6.34
Molecular weight91401.23
Publications
PubMed=21292972

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central

GO - Biological Function
GO - Biological Process
positive regulation of transcription, DNA-templated	GO:0045893	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP26818
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.68|      22|      23|     216|     238|       1
---------------------------------------------------------------------------
  216-  238 (33.85/26.80)	IRL.AYSFVDLAWTKDGEIlAVAC
  241-  263 (35.83/23.42)	IPLdPIVYCKLTIQKDDGV.EFSC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.41|      10|      23|     277|     286|       2
---------------------------------------------------------------------------
  277-  286 (18.62/10.89)	GLFPLQSGAN
  303-  312 (17.78/10.08)	GIFLVVNGIN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     111.04|      32|     147|     468|     499|       3
---------------------------------------------------------------------------
  468-  499 (56.66/35.11)	LLTGIDYWDVLIGLRSTMLDSLCE.RLTDSFNQ
  618-  650 (54.38/33.41)	LLNNLPDWRTATTTRGTMCDMLRDpKLLNMFRE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      86.43|      26|     195|     151|     193|       9
---------------------------------------------------------------------------
  164-  193 (39.74/24.35)	DKYIQVDMKPTirgfGGRPLQGFLVVGMTG
  362-  387 (46.69/28.43)	SRNVWVNGQEA....GSPPQHHLVIATVCG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP26818 with Med16 domain of Kingdom Metazoa
Unable to open file!