<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26813
Description |
Uncharacterized protein |
Sequence | MLMFTKFRHYILTTKQAVCVYFTDVVNPNSSEIKVLMLYSLLYSPDKEVYIDFIPKDQAGFYNKILTFIQLQKNKQVKKKCNFDNVEKDNAPKDEAWQSFALAGRKLSVYRHHQNSNK |
Length | 118 |
Position | Unknown |
Organism | Daphnia pulex (Water flea) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Crustacea> Branchiopoda>
Diplostraca> Cladocera> Anomopoda> Daphniidae> Daphnia.
|
Aromaticity | 0.14 |
Grand average of hydropathy | -0.472 |
Instability index | 40.28 |
Isoelectric point | 9.42 |
Molecular weight | 13918.95 |
Publications | PubMed=21292972
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP26813
No repeats found
No repeats found
|