<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26812
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MSTRETDEQQRIRFQVELEFVQCFANPNYLHFLAQRGYFKDPAFINYIKYLQYWKEPAYAKYLKYPMCLHFLDLLQYEHFRKEVVNGQCARFIDDQQILHWQHYTRKRVRLLQSQAEKHMMTVQNEPTPQKSV |
Length | 133 |
Position | Middle |
Organism | Daphnia pulex (Water flea) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Crustacea> Branchiopoda>
Diplostraca> Cladocera> Anomopoda> Daphniidae> Daphnia.
|
Aromaticity | 0.16 |
Grand average of hydropathy | -0.711 |
Instability index | 34.31 |
Isoelectric point | 8.96 |
Molecular weight | 16371.60 |
Publications | PubMed=21292972
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP26812
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 84.19| 18| 18| 59| 76| 1
---------------------------------------------------------------------------
27- 40 (20.17/ 7.65) ....PNYLHFLAQRGYFK
44- 61 (30.27/13.99) FINYIKYLQYWKEPAYAK
62- 79 (33.75/16.18) YLKYPMCLHFLDLLQYEH
---------------------------------------------------------------------------
|