<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26808
Description |
Uncharacterized protein |
Sequence | MQQQQFIQQQQLQQQQHQQQQHQQQPQQPQPQAQKDFNPASLCRFGQETVQELVSRVQECFQLLKNLQPPNGSAQSTSVAVDKKNKLDDQLKMVKVLFKRLRIIYNKCNENSQELDSYPLDSMLPTQSNLVDWKYADRVKSEQYLTAVDEKKELYDQILVKNRHLQDIMEYMRSIIWEINTMLMMRRP |
Length | 188 |
Position | Head |
Organism | Daphnia pulex (Water flea) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Crustacea> Branchiopoda>
Diplostraca> Cladocera> Anomopoda> Daphniidae> Daphnia.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.928 |
Instability index | 69.91 |
Isoelectric point | 8.38 |
Molecular weight | 22410.29 |
Publications | PubMed=21292972
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription, DNA-templated GO:0045893 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP26808
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.46| 15| 64| 80| 95| 1
---------------------------------------------------------------------------
80- 95 (22.28/19.40) AVDKKNKLDDQLkMVK
147- 161 (26.18/17.51) AVDEKKELYDQI.LVK
---------------------------------------------------------------------------
|