<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26803
| Description |
Mediator of RNA polymerase II transcription subunit 19 (Fragment) |
| Sequence | ADSLRRFEPNSPRSSPRGNRSPVVPRQQDSTGTLKTTISLGKTPTIVHTGPFYLHKELPGDTDLTGATNLMAHYNLEHSYNKFSGKKFKDSLSSFLPGLPGMIDTPGNTDNSSLRSIIEKPPIGGKELAFLNSSQLAGFRLHPGPLPEQYQTSSLAPLKKKQKHKKHK |
| Length | 168 |
| Position | Head |
| Organism | Daphnia pulex (Water flea) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Crustacea> Branchiopoda>
Diplostraca> Cladocera> Anomopoda> Daphniidae> Daphnia.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.783 |
| Instability index | 58.94 |
| Isoelectric point | 9.99 |
| Molecular weight | 18456.72 |
| Publications | PubMed=21292972
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP26803
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 108.96| 34| 40| 85| 120| 1
---------------------------------------------------------------------------
85- 120 (55.50/33.30) GKKFKDSLSSFLPGL...PGMIdtPGNTDNSSLRSIIEK
125- 161 (53.45/26.83) GKELAFLNSSQLAGFrlhPGPL..PEQYQTSSLAPLKKK
---------------------------------------------------------------------------
|