<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26802
| Description |
G1/S-specific cyclin C-like protein |
| Sequence | MAGNFWQSSHCQQWLLDPSDLVRERQGDFAIVTEEDYQKLFIFFSNFIQVLGEHLKLKQQVIATATVYFKRFYARNSLKCIDPLLLAPTCILLASKVEEFGVISNNRLITTCQSVVKSKFNYAYPQEFPYRAQHILECEFYLLENMDCCLVVYQPYRPLVQFVQDIGQEDLLGLSWKIVNDSLRTDISLLYPPYQIALAAMQMACVVLQKDGKNWFAEIAVDTDKIQEITRQILALYDLYKTYDEKKEIQGLLAKMPKPKTQPSR |
| Length | 265 |
| Position | Kinase |
| Organism | Daphnia pulex (Water flea) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Crustacea> Branchiopoda>
Diplostraca> Cladocera> Anomopoda> Daphniidae> Daphnia.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.103 |
| Instability index | 45.23 |
| Isoelectric point | 5.98 |
| Molecular weight | 30795.37 |
| Publications | PubMed=21292972
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
nucleus GO:0005634 IBA:GO_Central
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP26802
No repeats found
|