<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26795
Description |
Uncharacterized protein |
Sequence | MGQVDEVGFRPHPLPHHFSIHALIATHQTRDATHPSVNGDLISIPQPPSTMDRSQPSSSNLMGSYARPPQTRHRSPISIVVRPSSDTNAAQDNHNRLVADILTRYRTLMMLATVQAEGERSNATPETMAVSGISMKMEFDGLNSSIKDLLSLSRKIKELWVFGPLGQGDPDRKAKDAQIEDDVALVSALLNGLDGRRMRDLAHRCGGTWEVLAKEDATTAK |
Length | 221 |
Position | Head |
Organism | Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) (Metarhizium anisopliae (strain ARSEF 23)) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Clavicipitaceae> Metarhizium.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.483 |
Instability index | 39.92 |
Isoelectric point | 6.75 |
Molecular weight | 24236.13 |
Publications | PubMed=21253567
PubMed=25368161
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP26795
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.94| 12| 19| 46| 64| 2
---------------------------------------------------------------------------
46- 57 (24.42/20.60) QPPSTMDRSQPS
67- 78 (24.52/ 6.76) RPPQTRHRSPIS
---------------------------------------------------------------------------
|