| Description | Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MAEQEPHSLASTFPNPPPFWKDFTPDRVARIDELRSAFAGGASDHASSSVVRIPGLPEELTNLQPPPEPSDGRWRVFGDQYMLDDKLPTLEEQGITNLPTTGLSDSKDAKHYDRAFELKKLVKSLLLNFLELAGTLSRNPAHAEGKIQDLRTLFINIHHILNEYRPHQARESAIAMMQDHLDKTRSETDAIRMQVEKAKSVLEGLGKLGQGDVELAGEEGAGEAGDETENMRIRREMDLWAAADAEFAL |
| Length | 249 |
| Position | Middle |
| Organism | Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) (Metarhizium anisopliae (strain ARSEF 23)) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Clavicipitaceae> Metarhizium. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.584 |
| Instability index | 46.91 |
| Isoelectric point | 4.96 |
| Molecular weight | 27707.74 |
| Publications | PubMed=21253567 PubMed=25368161 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060 ECO:0000256 ARBA:ARBA00003669 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP26785
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.65| 13| 50| 6| 18| 1
---------------------------------------------------------------------------
6- 18 (26.78/14.76) PHSLASTFPNPPP
57- 69 (25.88/14.07) PEELTNLQPPPEP
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) RWRVFGDQYML 2) WKDFTPDRVARIDE | 73 20 | 83 33 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab