<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26784

Description Mediator of RNA polymerase II transcription subunit 13
SequenceMDAAEYDTNILVVNNIASISFRVYEPSSDQSSSFGLAAIDIENSLREKGHIVYYDASRRGIWHFRIVGKEGSDEVSSQELDSSLSLRGYSLVVGEEGSFEPSSLPRPRSQQPQTGHTPTSSTSSASALDQSQRYAPTATSHLGPPGLQEQDSKGYTSVTDAKLVQGGSSSPKAYESFVVATLLTIQSAFCRHTDSIPLNYRTVLLSQDILENDGSFDVVTEKTPTIGTFSAYLTTTGVLVVCMGISICRGLLSYGDMLNQASDIPGQQILAAPFGVIASNQPAAQFDGGTASMAQTPNTQALSLRGAPDIHNSLWKQACLKFLQLRGVAQSKLTDCFWINLLISKPKLQDAKSDVKRSPMPNSTVTIPWPSPLCFRKRPVEVSSTSRVGETILRGHEESHDPLGNAQSWFSSTPERDEKISKRKAERVATSSEGFGGDSRPTRLNGQSPLTLRRPSTAAAGSMYPTPPDALQNANGVTPSLDGTLSSPGNPLSAAAVPEVDNNGSVSMAMGDSFEPVRDFSESKRQRSDSNLLGEADHMFGDMGQDMFGDNDITEADFNFFDEEPEDIDLEAALDEMGDATTAAIIGAEEHTADEEISNSREPIKEEPETEKDAGGFTKPELRHAISVQNDHAMPRGRESRPVSMKRESSPFDPHTVFKRVCASLAATEKDGTIATDTNRMTKIFEKMDFDPTLPMINKKYEQGGQFDYSMSTAVGNSRLDHGVLPETDYLKRHGKLHRGSQEHKLYTKSLMGPLSGLERPISGRSPTKLDTQMSDDEQSSTESDQDDSSYTSDEPTSPPKSSVKQAPVEEDAVSQVTSLKEQDVIEEPDHQLAIELPRLSKPETPELPLSMLFSDPEPLALELSLGDEDLIQAAQILTEQAATGSLDLCNTDRPANTSIISQGRATLLSDSRTALQQLREALSVFLRGVEPVRLKAFLDIQDVLLQGQPRMQPRPIPGRDANAEQIRPSNLYQIPGPHLEVRRSDAKLSVLPSAVAFWESLGLAPSSGSKDITAVCVFPGWKGMADNVKTFLGRIKSVYEVLRLGSFENMALASDMDSGVLPYEMDRISTSPDATLTGHGSALIGTMETLRASLSNLTVSDTNVVVYFVYSPNNPGTIVEACAAFQRFFDSYQKDLAAKKETATNELVLQLVSSDLLSSPTSVVVTPSVDLVRLCMETYDRCTLFGGPMPAPAIRLEQPLPRIIDFKLNTQPSMSLIRENSCIHVAYAQTVDGRWVTTAWTDDRGNQQATASYCLGRKGRPLSTSMSEVAYEIWQSTLDLISAWTVHWRVIITKCGPMDQQEIDSWVNLAHTETRLQVTMILMTVDTDPWLQLVPPVVKLPHASVPFYTTPVSTPQANIVSPEQSATPATPANVTAATPGGGEAGADTETDAILADVTDQTWGAIVGHRLNNSLGVTDLYPALVSGFLIKRTGARVEDVPIAMEVNLIHTEAFPRSYEPLLREMLSYFRGLATLSRARGMVSRETDVRPWHIAAAEKAARAMYLLM
Length1507
PositionKinase
OrganismMetarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) (Metarhizium anisopliae (strain ARSEF 23))
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Clavicipitaceae> Metarhizium.
Aromaticity0.06
Grand average of hydropathy-0.350
Instability index51.28
Isoelectric point4.93
Molecular weight164151.29
Publications
PubMed=21253567
PubMed=25368161

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP26784
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     105.52|      34|      36|     519|     554|       1
---------------------------------------------------------------------------
  499-  516 (21.34/11.08)	................EVDNN.GSVSMAM.GDSFEP
  519-  554 (52.20/53.73)	DFSESKRQRSDSNLLGEADHMfGDMGQDMfGDNDIT
  557-  579 (31.98/20.92)	DFNFFDEEPEDIDLEAALDEM.GD............
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.10|      18|      21|     117|     134|       2
---------------------------------------------------------------------------
  117-  134 (30.49/16.82)	TPTSSTSSASALDQ.SQRY
  137-  155 (28.61/15.28)	TATSHLGPPGLQEQdSKGY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      75.04|      18|      21|     737|     756|       3
---------------------------------------------------------------------------
  737-  756 (27.37/22.60)	LHR...GSQEHKLYTKSlmGPLS
  758-  775 (19.45/ 8.45)	LERpisGRSPTKLDTQ.....MS
  781-  798 (28.23/15.97)	STE...SDQDDSSYTSD..EPTS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      86.51|      21|      21|     295|     315|       4
---------------------------------------------------------------------------
  280-  297 (29.46/16.55)	NQPAAQFDGGT.....ASMAQTP
  298-  318 (35.44/21.46)	NTQALSLRGAPD..IHNSLWKQA
  319-  338 (21.61/10.12)	CLKFLQLRGVAQskLTDCFW...
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      83.60|      19|      25|      57|      77|       5
---------------------------------------------------------------------------
   21-   33 (17.43/ 6.86)	.......FRVY.EPSSDQSSS
   57-   77 (31.27/30.41)	SRRGiwHFRIVGKEGSDEVSS
   85-  103 (34.90/24.18)	SLRG..YSLVVGEEGSFEPSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.62|      21|      21|     864|     884|       6
---------------------------------------------------------------------------
  864-  884 (32.60/20.34)	LSLGDEDLIQAAQILTEQAAT
  887-  907 (36.02/23.30)	LDLCNTDRPANTSIISQGRAT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     112.75|      33|      37|     369|     405|       7
---------------------------------------------------------------------------
  369-  402 (55.85/43.90)	WPSPLCFRKRPVEVSSTSRVGeTILRGHEESHDP
  409-  441 (56.90/31.65)	WFSSTPERDEKISKRKAERVA.TSSEGFGGDSRP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.79|      18|      21|     950|     970|       8
---------------------------------------------------------------------------
  463-  480 (34.13/15.61)	MYPTP.PDALQNANGVTPS
  952-  970 (30.65/25.08)	MQPRPiPGRDANAEQIRPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.87|      14|      21|    1040|    1053|      12
---------------------------------------------------------------------------
 1040- 1053 (23.57/14.22)	YEVLRLGSFENMAL
 1064- 1077 (24.30/14.91)	YEMDRISTSPDATL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP26784 with Med13 domain of Kingdom Fungi
Unable to open file!