<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26783
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MAADASQDVPMDMSPPAPPTDEPMYGGYSRFEIELEFVQSLANPFYLNHLASQKLLTQPAFVAYLAYLQYWTKPPYLKYLTYPGPTLKHLELLQEERFRQDIMSPDLVQKLVEDEMKASVQWHRE |
| Length | 125 |
| Position | Middle |
| Organism | Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) (Metarhizium anisopliae (strain ARSEF 23)) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Clavicipitaceae> Metarhizium.
|
| Aromaticity | 0.13 |
| Grand average of hydropathy | -0.442 |
| Instability index | 66.83 |
| Isoelectric point | 4.85 |
| Molecular weight | 14556.47 |
| Publications | PubMed=21253567
PubMed=25368161
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26783
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.97| 16| 28| 35| 50| 1
---------------------------------------------------------------------------
35- 50 (29.14/12.33) LEFVQSLANPFYLNHL
65- 80 (31.83/13.90) LAYLQYWTKPPYLKYL
---------------------------------------------------------------------------
|