Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MAADASQDVPMDMSPPAPPTDEPMYGGYSRFEIELEFVQSLANPFYLNHLASQKLLTQPAFVAYLAYLQYWTKPPYLKYLTYPGPTLKHLELLQEERFRQDIMSPDLVQKLVEDEMKASVQWHRE |
Length | 125 |
Position | Middle |
Organism | Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) (Metarhizium anisopliae (strain ARSEF 23)) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Clavicipitaceae> Metarhizium. |
Aromaticity | 0.13 |
Grand average of hydropathy | -0.442 |
Instability index | 66.83 |
Isoelectric point | 4.85 |
Molecular weight | 14556.47 |
Publications | PubMed=21253567 PubMed=25368161 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP26783 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 60.97| 16| 28| 35| 50| 1 --------------------------------------------------------------------------- 35- 50 (29.14/12.33) LEFVQSLANPFYLNHL 65- 80 (31.83/13.90) LAYLQYWTKPPYLKYL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MYGGYSRFEI 2) YLKYLTY | 24 76 | 33 82 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab