Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MLARAPLLSDICSQGASLHLGAPYSPSSTTGCITIPHSLLQNTSASVAAVANLVALAAQQAMSDDSPHKRKRSLGDTGDRDRDRDQKKMHLGDSRLGIEDLHLDVGEKYLLCRTPHPEPLTRIAQDLYEMCGLTSLAAEVAREKPNGEKNALRKTYKGHIKRLGVAGHFDVQKKKEDAPSEFMAILQVPELEWNVHQVKGREITDGLSATTLSNLGRAMNMSKGPIPKAVWDSSVLGDLAPSSGNASKPISAKPSAPGTPLASTPNTIGRPKPPILAGQDPNRPRRNVKKRSYGDSSFEGYGEGYPDDDGGMDTGYSTGEGEGGQKRRKKVGYDSTNGNESLSSDMALKNTAASPPNALMRQQSYGPGMVGA |
Length | 372 |
Position | Head |
Organism | Metarhizium acridum (strain CQMa 102) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Clavicipitaceae> Metarhizium. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.647 |
Instability index | 45.40 |
Isoelectric point | 8.86 |
Molecular weight | 39695.20 |
Publications | PubMed=21253567 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP26779 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 96.97| 29| 88| 243| 272| 1 --------------------------------------------------------------------------- 243- 272 (47.30/29.57) SGNASKPISAKPSAPGTPlASTPNTIGRPK 335- 363 (49.67/27.15) STNGNESLSSDMALKNTA.ASPPNALMRQQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ALMRQQSY 2) DMALK 3) QKRRKKVGYDST | 358 345 325 | 365 349 336 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab