<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26776
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MATLGLDEDELKSVEHTVARLAQLSSSIQSLKMDILKSNPLPHPSSLQASAQILQRNLQSVLESLNDNAELFTRMVIHPSTNYPGRTQENILTQLLRKKLEPDVEELVAEGRETARLATPEGVAELQAIWDELREWTQGRIAAYVRDEAGDVYTREEREAGVDNVRTGLRRGLDESDDDEDEADEDEDEGEDGDKGGKMVPRGPEPETLLWFGARGDFELPRNVEFERKVGVKRGLEGVNIPPERMDGVTSS |
| Length | 252 |
| Position | Head |
| Organism | Metarhizium acridum (strain CQMa 102) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Clavicipitaceae> Metarhizium.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.738 |
| Instability index | 45.05 |
| Isoelectric point | 4.50 |
| Molecular weight | 28132.78 |
| Publications | PubMed=21253567
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26776
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 111.99| 34| 39| 32| 65| 1
---------------------------------------------------------------------------
32- 65 (55.86/41.12) KMDILKSNPLPHPSSLQASAQILQRNLQSVLESL
74- 107 (56.13/41.36) RMVIHPSTNYPGRTQENILTQLLRKKLEPDVEEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 105.21| 26| 28| 147| 172| 2
---------------------------------------------------------------------------
113- 142 (24.62/ 9.28) .ETARLATPEgvaELQAIWDELRewTQ..GRIA
147- 172 (44.33/21.70) DEAGDVYTRE...EREAGVDNVR..TG..LRRG
177- 203 (36.26/16.61) DDDEDEADED...EDE.GEDGDK..GGkmVPRG
---------------------------------------------------------------------------
|