<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26773
Description |
Uncharacterized protein |
Sequence | MFDMGHAIACMMSNSPFVPQDGIRQVDVGFRPPTISRTTYFSINALVATHQTHDTTHPGFNGGLSSIPQTPTTMDRSQPSSSNLMDNHNRLVADILTRYRTLMMLATVQAEGERNNATPETMAVSGISMKMEFDGLNSSIKDLLSLSRKIKELWVFGPLGQGDPDRKAKDAQIEEDVALVSALLNSLDGRRMRELAQKCGGSWEVLVKEDATTAK |
Length | 215 |
Position | Head |
Organism | Metarhizium acridum (strain CQMa 102) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Clavicipitaceae> Metarhizium.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.348 |
Instability index | 42.59 |
Isoelectric point | 5.95 |
Molecular weight | 23614.60 |
Publications | PubMed=21253567
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP26773
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.05| 23| 40| 130| 153| 1
---------------------------------------------------------------------------
130- 153 (33.18/27.42) KMEFD.GLNSSIKDLLSlSRKIKEL
172- 195 (32.87/22.08) QIEEDvALVSALLNSLD.GRRMREL
---------------------------------------------------------------------------
|