Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MATDASKDVPMDTSPPAPPTDEPMYGGYSRFEIELEFVQSLANPFYLNHLASQKLLTQPAFVAYLAYLQYWTKPPYLKYLTYPGPTLKHLELLQEERFRQDIMSPDLVQKLAEDEMKASVQWHRE |
Length | 125 |
Position | Middle |
Organism | Metarhizium acridum (strain CQMa 102) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Clavicipitaceae> Metarhizium. |
Aromaticity | 0.13 |
Grand average of hydropathy | -0.505 |
Instability index | 59.71 |
Isoelectric point | 5.00 |
Molecular weight | 14528.39 |
Publications | PubMed=21253567 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP26771 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 60.97| 16| 28| 35| 50| 1 --------------------------------------------------------------------------- 35- 50 (29.14/13.25) LEFVQSLANPFYLNHL 65- 80 (31.83/14.93) LAYLQYWTKPPYLKYL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) PMYGGYSRFEIE 2) PYLKYLTYP | 23 75 | 34 83 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab