<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26759
| Description |
Uncharacterized protein |
| Sequence | MTKQNKPVATSLSSEPPQGARSSSVHVQNHRALWDQNPPNYPLQIAHHGALLSDEVFKFWLMADILTQLQTCLDQLATQFYATVAYLTTYHDHSPAIPPPNVPSAVPQLKKIPKNPPPAAPTSGTATNTPGAAGGPSGDTKDAAAGPSNAPQMQQQQQEQPPDAPPRPDSPNTFLMRQRELARDLIIKEQQIEYLISVLPGIKSSEAEQQERIKQLAEELRVVEEERSARRRELRRLGEKVDGLLGAVSRGTGISNSG |
| Length | 258 |
| Position | Middle |
| Organism | Coccidioides posadasii (strain RMSCC 757 / Silveira) (Valley fever fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Onygenales incertae sedis> Coccidioides.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.658 |
| Instability index | 64.71 |
| Isoelectric point | 6.60 |
| Molecular weight | 28136.28 |
| Publications | PubMed=20516208
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP26759
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 89.45| 28| 50| 177| 205| 1
---------------------------------------------------------------------------
177- 205 (42.54/30.64) RQRELaRDLIIKEQQIEYLISVLPGIKSS
230- 257 (46.91/29.49) RRREL.RRLGEKVDGLLGAVSRGTGISNS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.52| 13| 65| 91| 103| 2
---------------------------------------------------------------------------
91- 103 (27.43/11.22) HDHSPAIPP.PNVP
158- 171 (23.09/ 8.42) QEQPPDAPPrPDSP
---------------------------------------------------------------------------
|