Description | Uncharacterized protein |
Sequence | MQKYIIPNNGKTAQSPEYSSPSIGLKMDPQQPTSKAFQNRINADIAQLLQRFENIMAAATVRAVEDILALTRTMKELWLFGKLDMLGEDERDVRRREQLDKDVEMVKKAIDERLLKFLSQSLSRI |
Length | 125 |
Position | Head |
Organism | Coccidioides posadasii (strain RMSCC 757 / Silveira) (Valley fever fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Onygenales> Onygenales incertae sedis> Coccidioides. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.510 |
Instability index | 56.46 |
Isoelectric point | 8.96 |
Molecular weight | 14396.49 |
Publications | PubMed=20516208 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP26757 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) MQKYIIPN 2) RDVRRR | 1 91 | 8 96 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab