| Description | Uncharacterized protein |
| Sequence | MQKYIIPNNGKTAQSPEYSSPSIGLKMDPQQPTSKAFQNRINADIAQLLQRFENIMAAATVRAVEDILALTRTMKELWLFGKLDMLGEDERDVRRREQLDKDVEMVKKAIDERLLKFLSQSLSRI |
| Length | 125 |
| Position | Head |
| Organism | Coccidioides posadasii (strain RMSCC 757 / Silveira) (Valley fever fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Onygenales> Onygenales incertae sedis> Coccidioides. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.510 |
| Instability index | 56.46 |
| Isoelectric point | 8.96 |
| Molecular weight | 14396.49 |
| Publications | PubMed=20516208 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP26757 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) MQKYIIPN 2) RDVRRR | 1 91 | 8 96 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab