<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26756
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MEPSPDVPLEEITWHSPQHVQMMGGFLHSNNILFYFAESPFFDPTSNNASLALQAMHNENLRPFIETRGAFEGRLKTMQGLEFIVAHDPLLEAAAANAAAVARGEQPKEASNVWVIRKQMRRRSAAMGGQDDVQVLATYFVVGDSVFMAPSVWSVVGRRMLSTVTSLTKVLSTASALLTFSPSYGHSYLPHVPKSLEPTQLGQQSAQQSKETTPMPDMSGDKTTSRSALADASTTTLNASSLQDARDFAETLNLLARYGNEYIDETPLAGEPGSFIFTKASASVAEQLSVAGAGAQASRQNIRSGATTPVPFGAGRPASVQPDSTKGKAADRPPAATKDKGKKRKSKIGSMSQ |
| Length | 353 |
| Position | Head |
| Organism | Coccidioides posadasii (strain RMSCC 757 / Silveira) (Valley fever fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Onygenales incertae sedis> Coccidioides.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.342 |
| Instability index | 56.10 |
| Isoelectric point | 7.93 |
| Molecular weight | 37833.15 |
| Publications | PubMed=20516208
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26756
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 103.00| 33| 38| 196| 230| 1
---------------------------------------------------------------------------
196- 230 (50.51/30.16) LEPTQLgqQSAQQSKETTPMPDMSGDKTTSRSALA
237- 269 (52.49/26.38) LNASSL..QDARDFAETLNLLARYGNEYIDETPLA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.89| 22| 103| 23| 44| 2
---------------------------------------------------------------------------
23- 44 (43.38/32.19) MGGFLHSNNILFYF..AESPFFDP
127- 150 (36.51/25.97) MGGQDDVQVLATYFvvGDSVFMAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.89| 10| 14| 314| 323| 4
---------------------------------------------------------------------------
314- 323 (18.57/10.21) AGRPASVQPD
330- 339 (18.32/ 9.98) ADRPPAATKD
---------------------------------------------------------------------------
|