<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26753
| Description |
RNA polymerase II holoenzyme cyclin-like subunit |
| Sequence | MAADYWSSTQHQSWLFGREELAEARKVLGDAERPFIQQYPLPDLRLFNIYVNQQLIKLAKRLNVRQQALATAQVYVKRFYTKVEIRRTNPYLVLTTAFYLACKIEECPQHIRLVLGEARGLWPEFIAPDSAKIGECEFWLISEMNSQLIVHHPYRTLSELQSYLSLTSDEIALAWSVINDHYLTDLLLLHPPHVISVMAIFIAVVFKPNQHQVVSISGGSSATGALKDGSTNILSAFNDKTGAGMPAKVQRIVDWLANSDINIEAVIECTQDIVSLYEVWEQYSEKVCKEQIGRYVKSRGLDK |
| Length | 303 |
| Position | Kinase |
| Organism | Coccidioides posadasii (strain RMSCC 757 / Silveira) (Valley fever fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Onygenales incertae sedis> Coccidioides.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.080 |
| Instability index | 50.08 |
| Isoelectric point | 6.25 |
| Molecular weight | 34488.21 |
| Publications | PubMed=20516208
|
Function
| Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The SRB8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II.
Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The srb8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26753
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.87| 16| 18| 79| 94| 1
---------------------------------------------------------------------------
79- 94 (28.99/18.40) FY..TKVEIRRTNPYLVL
98- 115 (26.88/16.64) FYlaCKIEECPQHIRLVL
---------------------------------------------------------------------------
|