Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MEEGGQQKGITAAFPPPPPFWKNFTPENLERLEKAKKEAEPQALSRKWSPEALHALKLAPELRYLVPPELPKEGSYSLFGEAQSLSTQLPSLEEQGIEQLYPSSLTNETAGPSPDHAYYLLKISKSLLLNFLELVGILSINPEQYEPKIEDIRNLFINAHHLLNLYRPHQSRESLITMMEEQLEQAKEEIREMEQTKERVEIYLRELEAEGRNVSPNDEPVQTPESGPHNTKTQTSESQADGEQVMWKLLDEVEES |
Length | 256 |
Position | Middle |
Organism | Coccidioides posadasii (strain RMSCC 757 / Silveira) (Valley fever fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Onygenales> Onygenales incertae sedis> Coccidioides. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.762 |
Instability index | 58.16 |
Isoelectric point | 4.75 |
Molecular weight | 29227.45 |
Publications | PubMed=20516208 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060 ECO:0000256 ARBA:ARBA00003669 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP26745 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 126.67| 39| 39| 22| 60| 1 --------------------------------------------------------------------------- 22- 60 (65.11/35.88) KNFTPENLERLEKAKKEAEPQALSRKW.SPEALHALKLAP 63- 102 (61.56/33.56) RYLVPPELPKEGSYSLFGEAQSLSTQLpSLEEQGIEQLYP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 75.44| 23| 32| 108| 131| 2 --------------------------------------------------------------------------- 108- 131 (35.30/31.44) ETAGPSPDHAYYLLkISKSLLLNF 143- 165 (40.15/30.38) EQYEPKIEDIRNLF.INAHHLLNL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FWKNFTPENL 2) GEQVMWKLLDEVEES | 20 242 | 29 256 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab