<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26745
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MEEGGQQKGITAAFPPPPPFWKNFTPENLERLEKAKKEAEPQALSRKWSPEALHALKLAPELRYLVPPELPKEGSYSLFGEAQSLSTQLPSLEEQGIEQLYPSSLTNETAGPSPDHAYYLLKISKSLLLNFLELVGILSINPEQYEPKIEDIRNLFINAHHLLNLYRPHQSRESLITMMEEQLEQAKEEIREMEQTKERVEIYLRELEAEGRNVSPNDEPVQTPESGPHNTKTQTSESQADGEQVMWKLLDEVEES |
| Length | 256 |
| Position | Middle |
| Organism | Coccidioides posadasii (strain RMSCC 757 / Silveira) (Valley fever fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Onygenales incertae sedis> Coccidioides.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.762 |
| Instability index | 58.16 |
| Isoelectric point | 4.75 |
| Molecular weight | 29227.45 |
| Publications | PubMed=20516208
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP26745
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 126.67| 39| 39| 22| 60| 1
---------------------------------------------------------------------------
22- 60 (65.11/35.88) KNFTPENLERLEKAKKEAEPQALSRKW.SPEALHALKLAP
63- 102 (61.56/33.56) RYLVPPELPKEGSYSLFGEAQSLSTQLpSLEEQGIEQLYP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.44| 23| 32| 108| 131| 2
---------------------------------------------------------------------------
108- 131 (35.30/31.44) ETAGPSPDHAYYLLkISKSLLLNF
143- 165 (40.15/30.38) EQYEPKIEDIRNLF.INAHHLLNL
---------------------------------------------------------------------------
|