<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26744

Description Mediator of RNA polymerase II transcription subunit 16
SequenceMTALMWTIFLVTPIPWSWALPPLHRPGKVYLKDLTSYGFRDAVAWSKLGAIAYISNDGQKVFLQNILCNADDGEWSLCDGRFRCKIAEAQSGHTFIHLCWHESGSDLAIVDSCGRVMIVSMSIALNAFAVSRSIVIDPDDDGNQPVGLMWLGVNRPVHAFNKASKTNGRWVYSRYVRRPLGPFHPLNKSALVCVTRSGHIRLLYQSQDPKWNEVHVDLQTVSCSDDILTHAALSASQGGSILMVTYSTQHRLFVYRVQIKWDAAPVDTTQQQPVGISVAQTPTIQITHIRTEIQRSVFQRADNDYERSPSARVMPILTHLDIVGIASDGSAGSYVEPYILAAFAIPVSALETQRQFNGTSSIVRWALESTGQSTHSSFDEIPPKRQTLNLTPKTELTRWDDVHFDKRVLSIDYFEAGSVVSLTFDDGSISFYDAKTMNAISDNEDLATISITCISFSPNGCLAVTLDEDSELHLHVMEHSFGIEHGMYNDEQFGAAVAALALAFSHACSNDSSSDDVMMIAARSLTPDTRKTFITEVYHALSVNADFTIEQDKLMNNPYIQKCFSMQAALGFNGQLEQRNLAAAIPWFTLQLRQISILFAYFLHFNKSGSDSECHEPDILRMVLGNVRWALDLAKYLIDDLFEIASSFDKHSGDQSDKKLESFSMLLVLSSIPRAFLKYICRGLRGIPSSFRSATNLSTESFGVYSNIVRLIEESPLRVDVYEKFLLSIDNVIKYTYQNAGFGSTDRSIPERDLLITASVPPVLQPAVVTILTNTMTLIRPDVDLLHLCTWDYSWLGIDDDKLTRLFRRRNEVDILKKTITQLGEPQAKSKQPKRRCARCCAVSEDATSPKSLASFRLLVKTVVLRTCICGGLWMVENLDTISRGPVSAWK
Length891
PositionTail
OrganismCoccidioides posadasii (strain RMSCC 757 / Silveira) (Valley fever fungus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Onygenales> Onygenales incertae sedis> Coccidioides.
Aromaticity0.09
Grand average of hydropathy-0.072
Instability index44.69
Isoelectric point6.07
Molecular weight99556.41
Publications
PubMed=20516208

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP26744
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      98.82|      40|     135|     153|     198|       1
---------------------------------------------------------------------------
  153-  170 (12.69/13.81)	........................................VnrPVHAFNKASKTNG.....RW
  175-  198 (33.69/15.63)	YVRRPLGPFHP.LNKSALVCVTRSG......................................
  305-  365 (52.44/26.87)	YERSPSARVMPiLTHLDIVGIASDGsagsyvepyilaafaI..PVSALETQRQFNGtssivRW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     181.46|      42|      42|     622|     663|       2
---------------------------------------------------------------------------
  585-  617 (47.12/31.81)	.....IPWfTLQLRQ..ISILFAYFLHFNK.SG..SDSECHEP
  622-  663 (73.88/54.60)	MVLGNVRW.ALDLAKYLIDDLFEIASSFDKHSGDQSDKKLESF
  667-  702 (60.46/43.17)	LVLSSIPR.A..FLKYICRGLRGIPSSF.RSATNLST...ESF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      72.17|      26|      46|     442|     471|       6
---------------------------------------------------------------------------
  442-  471 (34.71/26.52)	DNEDL.ATISITCISFSpNGClavTLDEDSE
  489-  515 (37.46/18.27)	NDEQFgAAVAALALAFS.HAC...SNDSSSD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     116.15|      35|     125|     114|     148|       7
---------------------------------------------------------------------------
  114-  148 (60.57/41.50)	GRVMIVSMSIALNAFAVSRSIVID..P.DDDGNQPVGL
  239-  276 (55.58/37.46)	GSILMVTYSTQHRLFVYRVQIKWDaaPvDTTQQQPVGI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.39|      12|     688|      95|     106|       8
---------------------------------------------------------------------------
   95-  106 (27.19/18.25)	FIHLC.WHES..GSD
  785-  799 (17.21/ 8.71)	LLHLCtWDYSwlGID
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP26744 with Med16 domain of Kingdom Fungi
Unable to open file!