Description | Mediator of RNA polymerase II transcription subunit 22 (Fragment) |
Sequence | MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYY |
Length | 135 |
Position | Head |
Organism | Homo sapiens (Human) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Homo. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.724 |
Instability index | 66.00 |
Isoelectric point | 4.74 |
Molecular weight | 15857.69 |
Publications | PubMed=15164053 PubMed=21269460 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP26738 No repeats found No repeats found |
Disease | glomerular diseases PMID:33208756 |
MoRF Sequence | Start | Stop |
1) EIIKTAKIEDETQVSR 2) YNKRLK | 35 18 | 50 23 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab