<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26732
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MSSAAGNRRPRQITPTSPSPSPEPQPGTTNGSSSTNAPPPTSTLTQPPPSDPSATVASTDPTEAVRANLETRVRSVVDLLYQLAVCSADVQEGSQHLVANKVDECIQALAALDATKDEVHRAHMMIPQDVLEMLDTGKNPDIHTRNFVNRLASENQYSYGQHRAVESYKDRLDAALDQAFPELAQAQSGSTGTGE |
| Length | 195 |
| Position | Middle |
| Organism | Sporisorium reilianum (strain SRZ2) (Maize head smut fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Ustilaginomycetes> Ustilaginales> Ustilaginaceae> Sporisorium.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.636 |
| Instability index | 44.88 |
| Isoelectric point | 4.96 |
| Molecular weight | 20832.65 |
| Publications | PubMed=21148393
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26732
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 79.06| 16| 20| 25| 41| 1
---------------------------------------------------------------------------
9- 24 (29.50/ 9.59) RPRQITPTSPSPSPEP
26- 40 (21.99/ 7.34) .PGTTNGSSSTNAPPP
46- 61 (27.57/ 8.87) QPPPSDPSATVASTDP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.30| 12| 20| 109| 120| 2
---------------------------------------------------------------------------
109- 120 (19.85/11.22) LAALDATKD.EVH
131- 143 (17.45/ 9.28) LEMLDTGKNpDIH
---------------------------------------------------------------------------
|