Description | Uncharacterized protein |
Sequence | MDLLTQLDSDIDLLLKIMSSSVAFISRKAKHAVLLASTIPLTILGKTEAIEPDDMDHAIAELVDDLVAKADSIRAIIRHLPTEECLGGDVELEAELARLETEMQGANEGYREAVREAERLRAEVGELVRLISERQVEGRAWLVSELEGNHGAQATAVE |
Length | 158 |
Position | Middle |
Organism | Sporisorium reilianum (strain SRZ2) (Maize head smut fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina> Ustilaginomycetes> Ustilaginales> Ustilaginaceae> Sporisorium. |
Aromaticity | 0.02 |
Grand average of hydropathy | -0.059 |
Instability index | 32.55 |
Isoelectric point | 4.57 |
Molecular weight | 17310.47 |
Publications | PubMed=21148393 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP26731 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 56.87| 18| 32| 84| 104| 3 --------------------------------------------------------------------------- 84- 104 (26.90/22.72) ECLGGDVeleAELARLETEMQ 118- 135 (29.97/17.30) ERLRAEV...GELVRLISERQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AERLRA 2) SIRAIIRHLP 3) YREAVR | 117 72 110 | 122 81 115 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab