| Description | Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MQAAASASAAASTSKAGTASSTTEATTSSLLLSTLGAYSDLTKQLFSLIENPSTSKPRTIADASAGKTWTATDITGILSALHDVDQLFSSRIQIAHQHAINQSRIERLQAQAKRKDRETRRAILELSQIQSELSEITRLSEDEVASIERAEKQPIGHATLLAYAQRLARYTSAPPGYKLPQVASAAAAVGQNKDGADAVKTEQTDGQPAEPIALGADYNQYAKRAAAYYDPTIPSMPQEMPFPSDAMMRQGILNSHEMLNGAPMAEQPTDDMAEDQEELLPAQDFAASYSHLREQQQRQQDDEDAFDLDLN |
| Length | 311 |
| Position | Middle |
| Organism | Sporisorium reilianum (strain SRZ2) (Maize head smut fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina> Ustilaginomycetes> Ustilaginales> Ustilaginaceae> Sporisorium. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.550 |
| Instability index | 52.54 |
| Isoelectric point | 4.77 |
| Molecular weight | 33681.84 |
| Publications | PubMed=21148393 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP26723
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 81.58| 26| 177| 5| 63| 1
---------------------------------------------------------------------------
21- 47 (37.87/33.64) STTEATTSSLLLSTLGAYSDLtKQLFS
64- 89 (43.71/38.75) SAGKTWTATDITGILSALHDV.DQLFS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.83| 13| 182| 5| 17| 2
---------------------------------------------------------------------------
5- 17 (21.25/11.22) ASASAAASTSKAG
183- 195 (22.58/12.34) ASAAAAVGQNKDG
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) AAYYDPTI 2) DEDAFDLDLN 3) MAEDQEELLPAQDFAASYSHLREQQ | 226 302 272 | 233 311 296 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab