<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26720
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MSNLPQEAALPITNTLFPPPPPYFQAFTDEAIERYEALTGKSLLVNDQRDKSKDEKEKQDDRDIRLDSRMGDLTEEEQNEKLELERTLGRPRADWVIEDGRWMCFGTMYTTEPVIPTAQSIGLPPFVDPAAEPQESLPPLLHSFLHTLLLLLDTLTMTARTPNELAAAGWASEGDQYIQHLTNLSANMMVASNQLRSAQSEATLVLLMEKELEERRKQTEKLRSKCKEIASGIRALKGL |
Length | 239 |
Position | Middle |
Organism | Cryptococcus gattii serotype B (strain WM276 / ATCC MYA-4071) (Filobasidiella gattii) (Cryptococcus bacillisporus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Tremellomycetes>
Tremellales> Cryptococcaceae> Cryptococcus>
Cryptococcus gattii species complex.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.541 |
Instability index | 54.06 |
Isoelectric point | 4.84 |
Molecular weight | 26979.34 |
Publications | PubMed=21304167
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP26720
No repeats found
|