<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26713
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MAQATPRSHPPPYSLLQNLTTQSLLLSHLFTLIASPPNPNTSTQTQLTQVYSALQLSTLDLSGLVREVGQHQEAYRRLVEKKKEVAGLEMRVRGLVKRLEEGRKELEGMIDQGEKSLEDIEKSEREPLPAKTLMAHAQSLSKHSSAPVSSLLAPVDKAQYAPWPTEMSMRMGLLFQLEGSMSGMGERGVVGEEQKAPQKVEGRREHVEHEESGRRYDPNAIFQLDLNSDGSDED |
Length | 234 |
Position | Middle |
Organism | Cryptococcus gattii serotype B (strain WM276 / ATCC MYA-4071) (Filobasidiella gattii) (Cryptococcus bacillisporus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Tremellomycetes>
Tremellales> Cryptococcaceae> Cryptococcus>
Cryptococcus gattii species complex.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.658 |
Instability index | 50.08 |
Isoelectric point | 5.58 |
Molecular weight | 26054.12 |
Publications | PubMed=21304167
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP26713
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 29.36| 13| 16| 97| 109| 1
---------------------------------------------------------------------------
84- 104 (14.44/ 6.34) EVAGLemrvrglvKRLEEGRK
105- 122 (14.91/ 6.76) ELEGM...idqgeKSLEDIEK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.42| 23| 86| 37| 74| 2
---------------------------------------------------------------------------
10- 35 (32.90/14.69) PPP...........YSLLQnLTTqsLLLSHLFTLIAS
37- 70 (33.51/46.03) PNPntstqtqltqvYSALQ.LST..LDLSGLVREVGQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 57.51| 13| 16| 123| 135| 3
---------------------------------------------------------------------------
123- 135 (21.26/12.33) SEREPLPAKTLMA
141- 153 (18.66/10.00) SKHSSAPVSSLLA
158- 169 (17.59/ 9.04) AQYAPWPTEMSM.
---------------------------------------------------------------------------
|