Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MDDVLTTQFERVEKALSSLVESIATYNPSPQAALDLVAADDHLAHGLDQRTCHWNSLRGPFIYNSTVARHQANHARIQLLRAEAEGLEEQLKSSVEKLATLRHDLFDTPATIFPEHSRPVPFDELLQYASNISKHTVPPTYRERVPGPAGNQDKDREEANSSGALTNGVNTPAIQPEVPETAVALIEGQKNDESAAGAAPEITEEEAEWLKKLNQSQLSWYPWPSNDKIRQSSLYKIQAFREQNYDLNTFSIPAHEEAKRLKRLKRLQQALGQGSPEPQAEEVQPGIEAVQTIRRPVAQPTNIFDDMDDD |
Length | 310 |
Position | Middle |
Organism | Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) (Blackleg fungus) (Phoma lingam) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Leptosphaeriaceae> Leptosphaeria> Leptosphaeria maculans species complex. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.711 |
Instability index | 59.75 |
Isoelectric point | 4.98 |
Molecular weight | 34671.99 |
Publications | PubMed=21326234 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP26688 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 45.25| 13| 50| 205| 217| 1 --------------------------------------------------------------------------- 205- 217 (23.64/15.53) EEAEWLKKLNQSQ 256- 268 (21.61/13.68) EEAKRLKRLKRLQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 87.20| 28| 42| 31| 58| 2 --------------------------------------------------------------------------- 31- 58 (48.80/30.31) QAALDLVAAD.DHLAHGLDQRTCHWNSLR 74- 102 (38.40/22.56) HARIQLLRAEaEGLEEQLKSSVEKLATLR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GIEAVQTIRRPVAQPTNIFDDMDD 2) KRLKRLKRLQQAL 3) LSWYPWPS 4) LYKIQAFR | 286 259 218 234 | 309 271 225 241 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab