<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26686
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MPCPLLLHLAQPWCVTCTLRATQCSAIRWVDGVPTRSTPEHAHYLPYLENKTNVFTRVSPVKLLWSVEDLSGQPSPHDPTTRGGFICLLSWPAPAEAQSWSPSLGTNPPGSSAFISIHQHSSTFIILSTPSIPFHHPPLVNLVVVASHPPMASHSSQELPDVPGLAGYSRFELELEFVQCLANPVYLNYLAQQKTLDKPEFVAYLGYLQYFKEPRYAKFLHMCLQPPWSNSQGARATAAAALPQGDSLAPTCRQTHHRGPEECIAHPERLTAISMNERAVVCFRGGPVQSALTFLGGILTLYNRAAETILRTYLLLLTGPSWADNGPNGNDVVCSKFTRTEIPRNSRPYYILCIHSTSSTCFPSPRQNCFSHVIRYNEAPPPNRDPHVTTRHGDIAS |
Length | 397 |
Position | Middle |
Organism | Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) (Blackleg fungus) (Phoma lingam) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Pleosporineae> Leptosphaeriaceae>
Leptosphaeria> Leptosphaeria maculans species complex.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.200 |
Instability index | 50.44 |
Isoelectric point | 7.94 |
Molecular weight | 43922.57 |
Publications | PubMed=21326234
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP26686
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 124.39| 35| 88| 10| 50| 1
---------------------------------------------------------------------------
10- 38 (49.92/21.10) ........................AQPW.CVTCTLRATQCSAI.RWVDGV.PT.RST
201- 255 (31.89/25.05) FvAYLGylQyfkepryakflhmclQPPW.SNSQGARATAAAAL.PQGDSLaPTcRQT
256- 286 (42.58/15.52) H.HRGP..E...................eCIAHPERLTAISMNeRAV..V.CF.RGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 270.66| 78| 245| 70| 153| 2
---------------------------------------------------------------------------
70- 153 (130.99/68.53) LSGqPSPHDPTTRGG.FIC..LLSWPAPAEAQSWSpSLGTNPPGSSAFISIHQHSSTFIILSTPSIPFHHPPLvnlvVVASHPPMAS
317- 397 (139.67/60.56) LTG.PSWADNGPNGNdVVCskFTRTEIPRNSRPYY.ILCIHSTSSTCFPSPRQNCFSHVIRYNEAPPPNRDPH....VTTRHGDIAS
---------------------------------------------------------------------------
|