<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26685
| Description |
Mediator of RNA polymerase II transcription subunit 17 |
| Sequence | MSSMESLRDVKLRPWPASKQGTLSQQKLYAQIEQLTTERAHLRDITKTALQEALGAGKDIPDGVALKEKEDEEKKEKKEVVTQKVTRETIFNAQREMYSHLEWAKFAATNALDLLSLVLSQDPNKRVASSFSHTFREQGLEQGIPFGSFGISKESHEYFVPRPEEAERLEELAKKQLLVAKGSRMEALDSAADEILKAAKKLEKEVRRETKYWQEIVSVSDKGWPIQRLRQNARHVPFGVRFGLPEASDHFKARGFAPLRMSKDGSIILDPALALKPKTFRVRVTLDGETTGTSQLSVQQDMKDNSIEKSIQLARDSLFEEELYHEMSMETRQLLAYGVEFRDSVIQLDVPRMGNTSQQLKLLIDCIPRDEPIAESQSQSHNWLAQNVAEGLRLLLAHEHSMRLYRRSQVPPPLTARAQEKPPPPLLRTLLAVFRHLESVDSLYVYLETLKRTLDSAGLEMGLETTREVSWAKAAESLKTPKVGLSTSDQLLEIFNKPFDGKASIVLPTASGAPSEILSVVTRTVLAQPIFGTEHKLTLPASLTAELGLSQTIKFSSVDELTSYLDWILSSHIVHRIIKGEYSSRAVIKDEDTNVTILGQVSKKGSSASKKDVSIEVCDGSLKMKVTNLDCSSGSEGNAETSHSWDGSDDSTALKELLRSCVG |
| Length | 663 |
| Position | Head |
| Organism | Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) (Blackleg fungus) (Phoma lingam) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Pleosporineae> Leptosphaeriaceae>
Leptosphaeria> Leptosphaeria maculans species complex.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.432 |
| Instability index | 43.10 |
| Isoelectric point | 6.27 |
| Molecular weight | 73990.30 |
| Publications | PubMed=21326234
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26685
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.56| 20| 119| 65| 89| 1
---------------------------------------------------------------------------
65- 89 (27.78/31.17) ALKEKEDE....EKKEKKEvvtqkVTRET
187- 210 (27.78/18.08) ALDSAADEilkaAKKLEKE.....VRRET
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 189.59| 60| 223| 239| 298| 2
---------------------------------------------------------------------------
239- 298 (100.68/67.20) GVRFGLPEASDHFKARGFAPLRMSKDGSIILDPALALKPKTF..RVRVTLDGETTGTSQ.LSV
458- 520 (88.91/58.47) GLEMGLETTREVSWAKAAESLKTPKVGLSTSDQLLEIFNKPFdgKASIVLPTASGAPSEiLSV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.74| 24| 206| 135| 185| 3
---------------------------------------------------------------------------
147- 172 (37.56/62.46) GSFGISKESHEYfvPRPEEAERLEEL
634- 657 (42.18/10.90) GSEGNAETSHSW..DGSDDSTALKEL
---------------------------------------------------------------------------
|